Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
1
–
15
of
21,271
results
Novus Biologicals™ Universal Dopamine ELISA Kit (Colorimetric)
ELISA kits are ideal for the quantification of target antigens in tissue extracts, serum and cell culture.
| Host Species | Rabbit |
|---|---|
| Target Species | Human |
| Conjugate | HRP |
| Gene Symbol | SPINK4 |
| Assay Sensitivity | 19.53-1250 pg/mL |
| Storage Requirements | Storage is content dependent. |
| Assay Range | 19.53 pg/mL |
| For Use With (Application) | Sandwich ELISA |
| Assay | Sandwich ELISA |
| Regulatory Status | RUO |
| Target | SPINK4 |
| Specificity | This solid phase sandwich ELISA utilizes a monoclonal antibody specific for Human SPINK4. |
| Gene Alias | gastrointestinal peptide, MGC133107, serine peptidase inhibitor, Kazal type 4, serine protease inhibitor Kazal-type 4, serine protease inhibitor, Kazal type 4 |
| Product Type | Antibody Pairs |
| Gene ID (Entrez) | 27290 |
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunofluorescence |
| Form | Purified |
| Isotype | IgG |
| Research Discipline | Cancer |
| Antigen | TSSC4 |
| Regulatory Status | RUO |
| Purification Method | Antigen and protein A Affinity-purified |
| Dilution | Immunocytochemistry/ Immunofluorescence 1:100-1:500 |
| Gene Alias | protein TSSC4, tumor suppressing subtransferable candidate 4, Tumor-suppressing STF cDNA 4 protein, Tumor-suppressing subchromosomal transferable fragment candidate gene 4 protein |
| Gene ID (Entrez) | 10078 |
| Formulation | PBS (pH 7.0) |
| Immunogen | Produced in rabbits immunized with E. coli-derived Human TSSC4 fragment. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Gene Alias | C11orf15, chromosome 11 open reading frame 15, TMEM9 domain family, member B, transmembrane protein 9B |
| Molecular Weight (g/mol) | MolecularWeight-theroretical: 43.89 kDa |
| Gene ID (Entrez) | 56674 |
| Formulation | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Gene Symbol | TMEM9B |
| Research Category | Signal Transduction |
| Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
| For Use With (Application) | Western Blot,ELISA,Protein Array,Immunoaffinity Purification |
| Protein | TMEM9B |
| Content And Storage | Store at -20°C. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Form | Purified |
| Isotype | IgG |
| Research Discipline | Signal Transduction |
| Antigen | VPS37B |
| Regulatory Status | RUO |
| Purification Method | Affinity purified |
| Dilution | Western Blot 1:500-1:2000 |
| Gene Alias | ESCRT-I complex subunit VPS37B, FLJ12750, hVps37B, vacuolar protein sorting 37 homolog B (S. cerevisiae), vacuolar protein sorting 37B, vacuolar protein sorting 37B (yeast), vacuolar protein sorting-associated protein 37B |
| Gene ID (Entrez) | 79720 |
| Formulation | PBS (pH 7.3), 50% glycerol |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 60-170 of human VPS37B (NP_078943.1). LLYQPQLDTLKARLTQKYQELQVLFEAYQIKKTKLDRQSSSASLETLLALLQAEGAKIEEDTENMAEKFLDGELPLDSFIDVYQSKRKLAHMRRVKIEKLQEMVLKGQRLP |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Content And Storage | Store at -20° C. Avoid freeze/thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunohistochemistry,Immunofluorescence |
| Form | Purified |
| Isotype | IgG |
| Research Discipline | Core ESC Like Genes, Signal Transduction, Stem Cell Markers |
| Antigen | MgcRacGAP/RACGAP1 |
| Regulatory Status | RUO |
| Purification Method | Affinity purified |
| Dilution | Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200, Immunocytochemistry/Immunofluorescence 1:50-1:200 |
| Gene Alias | GTPase activating protein, HsCYK-4, ID-GAP, KIAA1478, Male germ cell RacGap, MGCRACGAP, MgcRacGAPrac GTPase-activating protein 1, Rac GTPase activating protein 1 |
| Gene ID (Entrez) | 29127 |
| Formulation | PBS, pH 7.4, 150mM NaCl, 50% glycerol. |
| Immunogen | A synthesized peptide derived from human MgcRacGAP/RACGAP1 (Uniprot #: Q9H0H5) |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | SR2170 |