missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human EPO (P01588, 28 a.a. - 193 a.a.) Partial Recombinant Protein expressed in CHO cells
Used for Func, SDS-PAGE
Brand: Abnova™ P3605.50ug
Additional Details : Weight : 0.00010kg
Description
This gene is a member of the EPO/TPO family and encodes a secreted, glycosylated cytokine composed of four alpha helical bundles. The protein is found in the plasma and regulates red cell production by promoting erythroid differentiation and initiating hemoglobin synthesis. This protein also has neuroprotective activity against a variety of potential brain injuries and antiapoptotic functions in several tissue types. [provided by RefSeq]
Sequence: APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDRSpecifications
| P01588 | |
| Lyophilized | |
| 35kDa | |
| Mammalian cell (CHO) expression system | |
| 50 ug | |
| Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months. Aliquot to avoid repeated freezing and thawing. | |
| <0.1ng/μg (1 EU/μg) | |
| EPO | |
| Activity was determined by the dose-dependent proliferation assay using a factor-dependent human erythroleukemic cell line TF-1 and was found to be 3.8 x 105 IU/mg. | |
| Recombinant | |
| Mammalian cell (CHO) expression system | |
| >90% by SDS-PAGE and HPLC |
| Functional Study, SDS-PAGE | |
| 2056 | |
| EPO (Human) Recombinant Protein | |
| Ion exchange column and HPLC reverse phase column | |
| APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR | |
| RUO | |
| EP/MGC138142 | |
| EPO | |
| Human | |
| None | |
| Lyophilized |