missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Helicobacter Pylori Omp Pylori Protein
A cDNA sequence encoding the Omp Pylori was constructed and used to recombinantly synthesize the protein.
228.00 € - 1740.00 €
Specifications
Name | Omp Pylori Protein |
---|---|
Regulatory Status | Research Use Only |
Endotoxin Concentration | Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. |
Product Type | Recombinant Protein |
Cross Reactivity | Helicobacter Pylori |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
15991969
|
enQuireBio™
QP12926-100UG |
100 μg |
228.00 €
100µg |
Estimated Shipment: 04-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
15911979
|
enQuireBio™
QP12926-500UG |
500 μg |
870.00 €
500µg |
Estimated Shipment: 04-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
15901979
|
enQuireBio™
QP12926-1MG |
1 mg |
1740.00 €
1mg |
Estimated Shipment: 04-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Specifications
Omp Pylori Protein | |
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
Helicobacter Pylori | |
Untagged | |
The Omp Pylori recombinant protein is formulated in 1xPBS pH 7.4. |
Research Use Only | |
Recombinant Protein | |
E. coli | |
MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMVDALLHFEEHGEVCPAGWRKGDKGMKATHQGVAEYLKENSIKL | |
Greater than 95% pure as determined by 12% PAGE (Coomassie staining). |