missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Helicobacter Pylori Omp Pylori Protein

A cDNA sequence encoding the Omp Pylori was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP12926-100ug

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15991969

Quantity Price
1 194.39 € / 100µg
6 182.42 € / 100µg
Estimated Shipment: 18-11-2021

Please to purchase this item. Need a web account? Register with us today!



Description

Description

Specifications

Specifications

Omp Pylori Protein
100 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Helicobacter Pylori
Untagged
The Omp Pylori recombinant protein is formulated in 1xPBS pH 7.4.
Greater than 95% pure as determined by 12% PAGE (Coomassie staining).
Research Use Only
Recombinant Protein
E. coli
MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMVDALLHFEEHGEVCPAGWRKGDKGMKATHQGVAEYLKENSIKL
Videos
SDS
Documents
Certificates