missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Helicobacter Pylori Omp Pylori Protein
A cDNA sequence encoding the Omp Pylori was constructed and used to recombinantly synthesize the protein.
Brand: enQuireBio™ QP12926-100ug
Additional Details : Weight : 0.01000kg
Specifications
Omp Pylori Protein | |
Research Use Only | |
Recombinant Protein | |
E. coli | |
MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMVDALLHFEEHGEVCPAGWRKGDKGMKATHQGVAEYLKENSIKL | |
Greater than 95% pure as determined by 12% PAGE (Coomassie staining). |
100 μg | |
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
Helicobacter Pylori | |
Untagged | |
The Omp Pylori recombinant protein is formulated in 1xPBS pH 7.4. |