missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Hepatitis B HBsAg preS1 Protein

A cDNA sequence encoding the HBsAg preS1 was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP12128-50ug

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15989458

Quantity Price
1 171.64 € / 50µg
10 161.27 € / 50µg
Estimated Shipment: 18-11-2021

Please to purchase this item. Need a web account? Register with us today!



Description

Description

Specifications

Specifications

Hepatitis B HBsAg preS1 Protein
50 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Hepatitis B
Untagged
HBsAg protein was lyophilized from 0.2?m filtered (1 mg/ml) solution in 20mM PBS, pH 7.4, and 50mM NaCl.
HBsAg Protein is >95% pure as determined by 10% PAGE (coomassie staining).
Research Use Only
Recombinant Protein
E. coli
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQA
Videos
SDS
Documents
Certificates