missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant HIV-1 Integrase Protein
A cDNA sequence encoding the HIV-1 Integrase was constructed and used to recombinantly synthesize the protein.
228.00 € - 1740.00 €
Specifications
Name | HIV-1 Integrase Protein |
---|---|
Regulatory Status | Research Use Only |
Endotoxin Concentration | Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. |
Product Type | Recombinant Protein |
Cross Reactivity | HIV |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
15919838
|
enQuireBio™
QP12252-100UG |
100 μg |
228.00 €
100µg |
Estimated Shipment: 09-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
15939838
|
enQuireBio™
QP12252-500UG |
500 μg |
870.00 €
500µg |
Estimated Shipment: 09-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
15929838
|
enQuireBio™
QP12252-1MG |
1 mg |
1740.00 €
1mg |
Estimated Shipment: 09-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Specifications
HIV-1 Integrase Protein | |
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
HIV | |
His | |
1.5M urea, 25mM Tris-HCl pH 8.0, 0.2% Triton-X and 50% Glycerol. |
Research Use Only | |
Recombinant Protein | |
E. coli | |
mfldgidkaqeehekyhsnwramasdfnlppvvakeivascdkcqlkgeamhgqvdcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfilklagrwpvktihtdngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlktavqmavfihnfkrkggiggysagerivdiiatdiqtkelqkqitkiqnfrvyyrdsrdplwkgpakllwkgegavviqdnsdikvvprrkakiirdygkqmagddcvasrqdedhhhhhh | |
Greater than 95.0% as determined by SDS-PAGE. |