missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human En Protein

A cDNA sequence encoding the En was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP10586-2ug

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15984328

Quantity Price
1 114.77 € / 2µg
10 107.33 € / 2µg
Estimated Shipment: 26-11-2021

Please to purchase this item. Need a web account? Register with us today!



Description

Description

Specifications

Specifications

2022
Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Research Use Only
ENG
Recombinant Protein
Insect
MDRGTLPLAVALLLASCSLSPTSLAETVHCDLQPVGPERGEVTY TTSQVSKGCVAQAPNAILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVL SVNSSVFLHLQALGIPLHLAYNSSLVTFQEPPGVNTTELPSFPKTQILEWAAERGPI TSAAELNDPQSILLRLGQAQGSLSFCMLEASQDMGRTLEWRPRTPALVRGCHLE GVAGHKEAHILRVLPGHSAGPRTVTVKVELSCAPGDLDAVLILQGPPYVSWLID ANHNMQIWTTGEYSFKIFPEKNIRGFKLPDTPQGLLGEARMLNASIVASFVELPL ASIVSLHASSCGGRLQTSPAPIQTTPPKDTCSPELLMSLIQTKCADDAMTLVLKKE LVAHLKCTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASMISNEAVVNI LSSSSPQRKKVHCLNMDSLSFQLGLYLSPHFLQASNTIEPGQQSFVQVRVSPSVSE FLLQLDSCHLDLGPEGGTVELIQGRAAKGNCVSLLSPSPEGDPRFSFLLHFYTVPI PKTGTLSCTVALRPKTGS
En Protein
2 μg
< 1.0 EU per ug protein as determined by the LAL method.
Measured by its ability to bind with rhTGF-beta RII/Fc in a functional ELISA. Optimal dilutions should be determined by each laboratory for each application.
Human
His
Endoglin was lyophilized from a concentrated (1 mg/ml) sterile solution containing 1xPBS.
Videos
SDS
Documents
Certificates