missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human FLT1 D3 Protein

A cDNA sequence encoding the FLT1 D3 was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP10612-10ug

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15984408

Quantity Price
1 171.64 € / 10µg
10 161.27 € / 10µg
Estimated Shipment: 23-11-2021

Please to purchase this item. Need a web account? Register with us today!



Description

Description

Specifications

Specifications

2321
Greater than 90.0% as determined by SDS-PAGE.
Research Use Only
FLT1
Recombinant Protein
Insect
SKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSI TKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYI FISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDT LIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQT NTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRA SVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSV HIYDKAFITVKHRKQQVLETVAGKRSY
FLT1 D3 Protein
10 μg
< 1.0 EU per ug protein as determined by the LAL method.
The activity of FLT1D1-3 was determined by its ability to inhibit the VEGF-165-induced proliferation of HUVE cells.
Human
Untagged
FLT1 D1-3 was lyophilized from a concentrated (1 mg/ml) sterile solution containing 1xPBS.
Videos
SDS
Documents
Certificates