missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Human GNLY Protein
A cDNA sequence encoding the GNLY was constructed and used to recombinantly synthesize the protein.
131.00 € - 5945.00 €
Specifications
Name | GNLY Protein |
---|---|
Regulatory Status | Research Use Only |
Endotoxin Concentration | Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. |
Product Type | Recombinant Protein |
Cross Reactivity | Human |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
15959118
|
enQuireBio™
QP12021-2UG |
2 μg |
131.00 €
2µg |
Estimated Shipment: 31-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
15939118
|
enQuireBio™
QP12021-10UG |
10 μg |
203.00 €
10µg |
Estimated Shipment: 31-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
15949118
|
enQuireBio™
QP12021-1MG |
1 mg |
5945.00 €
1mg |
Estimated Shipment: 31-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Specifications
GNLY Protein | |
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
Human | |
His | |
The Granulysin protein was lyophilized from a concentrated (1 mg/ml) solution containing no additives. |
Research Use Only | |
Recombinant Protein | |
E. coli | |
MGSSHHHHHHSSGLVPRGSHMMEGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPLGSHHHHHH | |
Greater than 95.0% as determined by SDS-PAGE. |