missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human MOG Protein

A cDNA sequence encoding the MOG was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP12718-10ug

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15991319

Quantity Price
1 114.77 € / 10µg
10 107.33 € / 10µg
Estimated Shipment: 08-11-2021

Please to purchase this item. Need a web account? Register with us today!



Description

Description

Specifications

Specifications

MOG Protein
10 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Human
His
The Myelin Oligodendrocyte Glycoprotein 0.5 mg/ml solution was lyophilized from 20mM sodium acetate buffer pH 4 and 0.3M sodium chloride.
Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Research Use Only
Recombinant Protein
E. coli
MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGHHHHHH
Videos
SDS
Documents
Certificates