missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human OTOR Protein

A cDNA sequence encoding the OTOR was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP12938-20ug

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15992009

Quantity Price
1 171.64 € / 20µg
10 161.27 € / 20µg
Estimated Shipment: 23-11-2021

Please to purchase this item. Need a web account? Register with us today!



Description

Description

Specifications

Specifications

56914
Greater than 98.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Research Use Only
OTOR
Human
Untagged
The OTOR protein was lyophilized from a concentrated (1 mg/ml) solution containing 20mM PBS pH 7.4 and 130mM NaCl.
OTOR Protein
20 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Recombinant Protein
E. coli
VHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE
Videos
SDS
Documents
Certificates