missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human SELE Protein

A cDNA sequence encoding the SELE was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP13450-1mg

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15983599

Quantity Price
1 2518.82 € / 1mg
3 2369.46 € / 1mg
Estimated Shipment: 18-11-2021

Please to purchase this item. Need a web account? Register with us today!



Description

Description

Specifications

Specifications

SELE Protein
1 mg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Human
His
SELE was lyophilized from a 0.2 microm filtered solution of PBS and 4% Mannitol, pH 7.5.
Greater than 95% as determined by SDS-PAGE.
Research Use Only
Recombinant Protein
HEK 293
WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPVDHHHHHH
Videos
SDS
Documents
Certificates