missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Mouse IL 17 A/F Protein
A cDNA sequence encoding the IL 17 A/F was constructed and used to recombinantly synthesize the protein.
131.00 € - 1305.00 €
Specifications
Name | IL 17 A/F Protein |
---|---|
Regulatory Status | Research Use Only |
Endotoxin Concentration | Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. |
Product Type | Recombinant Protein |
Cross Reactivity | Mouse |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
15970269
|
enQuireBio™
QP12392-2UG |
2 μg |
131.00 €
2µg |
Estimated Shipment: 04-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
15960269
|
enQuireBio™
QP12392-10UG |
10 μg |
203.00 €
10µg |
Estimated Shipment: 04-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
15950269
|
enQuireBio™
QP12392-0.1MG |
100 μg |
1305.00 €
100µg |
Estimated Shipment: 21-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Specifications
IL 17 A/F Protein | |
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
Mouse | |
Untagged | |
Lyophilized from a concentrated (1 mg/ml) solution containing no additives. |
Research Use Only | |
Recombinant Protein | |
E. coli | |
RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA | |
Greater than 97.0% as determined by SDS-PAGE. |