missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Rabbit GHBP Protein
A cDNA sequence encoding the GHBP was constructed and used to recombinantly synthesize the protein.
131.00 € - 4880.00 €
Specifications
Name | GHBP Protein |
---|---|
Regulatory Status | Research Use Only |
Endotoxin Concentration | < 1.0 EU per ug protein as determined by the LAL method. |
Biological Activity | Evidenced by its ability of forming 2:1 complex with non-primate Growth Hormones. |
Product Type | Recombinant Protein |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
15964498
|
enQuireBio™
QP10642-5UG |
5 μg |
131.00 €
5µg |
Estimated Shipment: 30-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
15954498
|
enQuireBio™
QP10642-20UG |
20 μg |
203.00 €
20µg |
Estimated Shipment: 30-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
15944498
|
enQuireBio™
QP10642-1MG |
1 mg |
4880.00 €
1mg |
Estimated Shipment: 30-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Specifications
GHBP Protein | |
< 1.0 EU per ug protein as determined by the LAL method. | |
Recombinant Protein | |
E. coli | |
AFSGSEATPATLGRASESVQRVHPGLGTNSSGKPKFTKCRSPELETFSCHWTDGVHHGLKSPGSVQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTNNGGMVDQKCFSVEEIVQPDPPIGLNWTLLNVSLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRSSEKYGEFSEVLYVTLPQMSPFTCEEDFRFP | |
Greater than 98.0% as determined bySDS-PAGE. |
Research Use Only | |
Evidenced by its ability of forming 2:1 complex with non-primate Growth Hormones. | |
Rabbit | |
Untagged | |
The Growth Hormone Binding Protein Rabbit was lyophilized from a concentrated (1 mg/ml) solution with 0.0045mM NaHCO3. |