missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Rat Tpc1808 Protein
A cDNA sequence encoding the Tpc1808 was constructed and used to recombinantly synthesize the protein.
131.00 € - 2610.00 €
Specifications
| Name | Tpc1808 Protein |
|---|---|
| Regulatory Status | Research Use Only |
| Endotoxin Concentration | Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. |
| Product Type | Recombinant Protein |
| Cross Reactivity | Rat |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
15914719
|
enQuireBio™
QP13791-10UG |
10 μg |
131.00 €
10µg |
Estimated Shipment: 05-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
|
15934719
|
enQuireBio™
QP13791-50UG |
50 μg |
203.00 €
50µg |
Estimated Shipment: 05-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
|
15924719
|
enQuireBio™
QP13791-1MG |
1 mg |
2610.00 €
1mg |
Estimated Shipment: 05-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Specifications
| Tpc1808 Protein | |
| Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
| Rat | |
| His | |
| The Tropic-1808 was lyophilized from 1X PBS, pH 7.4. |
| Research Use Only | |
| Recombinant Protein | |
| E. coli | |
| MSYYHHHHHHMNLAQIAALNQISNLNAIRVGQVLKVSNAAGSNNTQNTTQPSAGVPTNTASSTTGYTVKSGDTLSAIAAANGVSLANLLSWNNLSLQAIIYPGQKLTIQNANNATVTTPNAPTSTPTVMPSTNGSYTVKSGDTLYGIAAKLGTNVQTLLSLNGLQLSSTIYVGQVLKTTGAVAGAGTATSTPTPVTPTVSKPAAANGVSTAGLSAAQAAWLRTAVVDAQAATAGTGVLASVTVAQAILESGWGQSALASAPYHNFNLYLIKVKNTWKLMTLLLS | |
| Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |