missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant SARS SARS MERS Protein
A cDNA sequence encoding the SARS MERS was constructed and used to recombinantly synthesize the protein.
228.00 € - 1740.00 €
Specifications
Name | SARS SARS MERS Protein |
---|---|
Regulatory Status | Research Use Only |
Endotoxin Concentration | Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. |
Product Type | Recombinant Protein |
Cross Reactivity | SARS |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
15913509
|
enQuireBio™
QP13419-100UG |
100 μg |
228.00 €
100µg |
Estimated Shipment: 05-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
15933509
|
enQuireBio™
QP13419-500UG |
500 μg |
870.00 €
500µg |
Estimated Shipment: 05-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
15923509
|
enQuireBio™
QP13419-1MG |
1 mg |
1740.00 €
1mg |
Estimated Shipment: 05-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Specifications
SARS SARS MERS Protein | |
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
SARS | |
His | |
SARS MERS protein solution is supplied in PBS, 25mM arginine and 0.05% sodium azide. |
Research Use Only | |
Recombinant Protein | |
E. coli | |
EAKPSGSVVEQAEGVECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYHHHHHH | |
Protein is >95% pure as determined by 12% PAGE (coomassie staining). |