Learn More
Nicotinic Acetylcholine R alpha 5/CHRNA5 Rabbit anti-Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Rabbit, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
Brand: Novus Biologicals NBP1-69122
Description
Nicotinic Acetylcholine R alpha 5/CHRNA5 Polyclonal specifically detects Nicotinic Acetylcholine R alpha 5/CHRNA5 in Human, Mouse samples. It is validated for Western Blot.Specifications
| Nicotinic Acetylcholine R alpha 5/CHRNA5 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| Cholinergic receptor, neuronal nicotinic, alpha polypeptide-5, cholinergic receptor, nicotinic, alpha 5, cholinergic receptor, nicotinic, alpha polypeptide 5, LNCR2, NACHRA5, neuronal acetylcholine receptor subunit alpha-5, neuronal nicotinic acetylcholine receptor, alpha5 subunit | |
| Rabbit | |
| 53 kDa | |
| 100 μL | |
| Primary | |
| This product is specific to Subunit or Isoform: alpha-5. | |
| Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Rabbit | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS & 2% Sucrose. with 0.09% Sodium Azide | |
| CHRNA5 | |
| Synthetic peptides corresponding to CHRNA5 (cholinergic receptor, nicotinic, alpha 5) The peptide sequence was selected from the middle region of CHRNA5. Peptide sequence PDIVLFDNADGRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFD. | |
| Affinity Purified | |
| RUO | |
| 1138 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at -20C. Avoid freeze-thaw cycles. |
The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.
For Research Use Only