missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CALY Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
198.00 € - 462.00 €
Specifications
| Antigen | CALY |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
CALY Polyclonal antibody specifically detects CALY in Mouse samples. It is validated for Western BlotSpecifications
| CALY | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Neurodegeneration, Neuroscience | |
| PBS with 50% glycerol, pH7.3. | |
| 50632 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Mouse | |
| calcyon D1 dopamine receptor-interacting protein (CALCYON), calcyon neuron-specific vesicular protein, DRD1IP | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-87 of human CALY (NP_056537.1). MVKLGCSFSGKPGKDPGDQDGAAMDSVPLISPLDISQLQPPLPDQVVIKTQTEYQLSSPDQQNFPDLEGQRLNCSHPEEGRRLPTAR | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title