missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30199681

Invitrogen™ Human AHNAK (aa 5583-5716) Control Fragment Recombinant Protein

Product Code. 30199681
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199681

Brand: Invitrogen™ RP92506

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53890 (PA5-53890. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

AHNAK1 (Desmoyokin) is a large (700 kDa) scaffold protein that translocates to the plasma membrane after an increas of extracellular calcium level or upon proteinkinase C activation and regulates extracellular calcium influx mediated by L-type Ca2+ channels. AHNAK1 has been implicated in diverse signal transduction proceses affecting cell differentiation and proliferation. In response to calcium-dependent intercellular contacts AHNAK1 forms multimeric complexes in the plasma membrane, connected with actin and annexin 2/S100A10 assemblies and is thus involved in organization of the plasma membrane architecture. In epithelial cells, AHNAK1 is localized in cytoplasm or is membrane-associated, but in cells of nonepithelial origin AHNAK1 is predominantly nuclear; it has a weak DNA-binding activity and associates with the DNA-ligase IV-XRCC4 complex.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q09666
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 79026
Name Human AHNAK (aa 5583-5716) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AHNAK; AHNAK 1; AHNAK nucleoprotein; AHNAK nucleoprotein (desmoyokin); AHNAK-related; AHNAKRS; Desmoyokin; DY6; MGC5395; Neuroblast differentiation-associated protein AHNAK; PM227; RGD1308572; UV118
Common Name AHNAK
Gene Symbol AHNAK
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LGEGHLSVKGSGGEWKGPQVSSALNLDTSKFAGGLHFSGPKVEGGVKGGQIGLQAPGLSVSGPQGHLESGSGKVTFPKMKIPKFTFSGRELVGREMGVDVHFPKAEASIQAGAGDGEWEESEVKLKKSKIKMPK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.