missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30208363

Invitrogen™ Human ATMIN (aa 72-167) Control Fragment Recombinant Protein

Product Code. 30208363
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30208363

Brand: Invitrogen™ RP106587

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65908 (PA5-65908. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The ATM/ATR-substrate CHK2-interacting zinc finger protein (ATMIN), also known as ASCIZ, forms DNA damage-induced nuclear foci that contain the DNA repair protein Rad51. ATMIN is also thought to be involved in embryonic development, as an absence of ATMIN causes late-embryonic lethality in mice with a range of organ development defects. It also activates the transcription DYNLL1, a light chain of the dynein motor complex and sequence-specific regulator of protein dimerization of numerous targets. DYNLL1 can bind to and inhibit the transcription activation domain of ATMIN, forming a simple dynamic feedback loop for DYNLL1 expression.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O43313
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23300
Name Human ATMIN (aa 72-167) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ASCIZ; ATM INteracting protein; ATM interactor; ATM/ATR-substrate CHEK2-interacting zinc finger protein; ATM/ATR-substrate CHK2-interacting zinc finger protein; ATM/ATR-Substrate Chk2-Interacting Zn++-finger protein; ATM/ATR-Substrate Chk2-Interacting Zn2+-finger protein; atmin; gpg6; KIAA0431; mKIAA0431; RGD1305781; Zinc finger protein 822; ZNF822
Common Name ATMIN
Gene Symbol ATMIN
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SVSELSRAVRTNILCTVRGCGKILPNSPALNMHLVKSHRLQDGIVNPTIRKDLKTGPKFYCCPIEGCPRGPERPFSQFSLVKQHFMKMHAEKKHKC
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.