missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30200569

Invitrogen™ Human ATP13A2 (aa 762-844) Control Fragment Recombinant Protein

Product Code. 30200569
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200569

Brand: Invitrogen™ RP103955

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111322 (PA5-111322. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Neurodegenerative disorders such as Parkinson and Alzheimer disease cause motor and cognitive dysfunction and belong to a heterogeneous group of common and disabling disorders. ATP13A2, otherwise known as PARK9, is a neuronal P-type ATPase gene underlying an autosomal recessive form of early-onset parkinsonism with pyramidal degeneration and dementia. ATP13A2 protein is located in the membrane of these lysosomes and is formed most strongly in the brain, especially in the substantia nigra, a brain region which is known to play a central role in Parkinson's disease.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NQ11
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23400
Name Human ATP13A2 (aa 762-844) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110012E06Rik; AA589443; AT132 antibody; Atp13a2; ATPase 13A2; ATPase type 13A2; Cation-transporting ATPase 13A2; CLN12; HSA9947; HSA9947 antibody; KRPPD; PARK9; probable cation-transporting ATPase 13A2; putative ATPase; RGD1307977; RP1-37C10.4
Common Name ATP13A2
Gene Symbol ATP13A2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RGCGMVAPQEHLIIVHATHPERGQPASLEFLPMESPTAVNGVKDPDQAASYTVEPDPRSRHLALSGPTFGIIVKHFPKLLPKV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.