missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ATP6V0A1 (aa 35-129) Control Fragment Recombinant Protein

Product Code. 30194617
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30194617

Brand: Invitrogen™ RP93230

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54570 (PA5-54570. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ATP6V0A1 encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene encodes one of three A subunit proteins and the encoded protein is associated with clathrin-coated vesicles.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q93050
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 535
Name Human ATP6V0A1 (aa 35-129) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias a1; AA959968; adenosine triphosphatase; ATP6a1; ATP6N1; ATP6N1A; Atp6v0a1; ATPase H+ transporting lysosomal (vacuolar proton pump) noncatalytic accessory protein 1 (110/160 kDa); ATPase H+ transporting V0 subunit a1; ATPase, H+ transporting, lysosomal (vacuolar proton pump) noncatalytic accessory protein 1 (110/160 kDa); ATPase, H+ transporting, lysosomal (vacuolar proton pump) non-catalytic accessory protein 1 A (110/116 kD); ATPase, H+ transporting, lysosomal (vacuolar proton pump) noncatalytic accessory protein 1 A (110/160 kDa); ATPase, H+ transporting, lysosomal non-catalytic accessory protein 1 (110/116 kD); ATPase, H+ transporting, lysosomal noncatalytic accessory protein 1 A; ATPase, H+ transporting, lysosomal V0 subunit a; ATPase, H+ transporting, lysosomal V0 subunit a1; Atpv0a1; Clathrin-coated vesicle/synaptic vesicle proton pump 116 kDa subunit; H(+)-transporting two-sector ATPase, 116 kDa accessory protein A1; Stv1; V-A; vacuolar adenosine triphosphatase subunit Ac116; vacuolar H+-ATPase subunit; vacuolar proton pump subunit 1; vacuolar proton translocating ATPase 116 kDa subunit A; Vacuolar proton translocating ATPase 116 kDa subunit a isoform 1; vacuolar proton-translocating ATPase a1 isoform; vacuolar-type H(+)-ATPase 115 kDa subunit; V-ATPase 116 kDa; V-ATPase 116 kDa isoform a1; V-ATPase 116 kDa subunit; V-ATPase 116 kDa subunit a1; V-ATPase a1; v-H+ATPase subunit a1; Vph1; Vpp1; Vpp-1; V-type proton ATPase 116 kDa subunit a; V-type proton ATPase 116 kDa subunit a isoform 1; V-type proton ATPase 116 kDa subunit a isoform 1; V-type proton ATPase 116 kDa subunit a; V-type proton ATPase 116 kDa subunit a1
Common Name ATP6V0A1
Gene Symbol ATP6V0A1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPEVPFPRDMIDLEANFEKIENELKEINTNQEALKRNFLELTELK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.