missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30206988

Invitrogen™ Human BST-1 (aa 37-110) Control Fragment Recombinant Protein

Product Code. 30206988
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30206988

Brand: Invitrogen™ RP101192

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Bone marrow stromal cell antigen 1 (BST1) is a stromal cell line-derived glycosylphosphatidylinositol-anchored molecule that facilitates pre-B cell growth. BST1, which is also known as ADP-rybosyl cyclase 2 and DAMP-1, is an enzyme which is expressed by BST1 gene in human. BST1 expression is enhanced in bone marrow stromal cell lines derived from patients with rheumatoid arthritis. The polyclonal B cell abnormalities in rheumatoid arthritis may be, at least in part, attributed to BST1 overexpression in the stromal cell population.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q10588
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 683
Name Human BST-1 (aa 37-110) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 114/A10; A530073F09; ADP-ribosyl cyclase 2; ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2; antigen BP3; Bone marrow stromal antigen 1; bone marrow stromal cell antigen 1; Bp3; Bp-3; BP-3 alloantigen; Bst1; BST-1; Bsta1; cADPr hydrolase 2; CD157; CD157 antigen; Cyclic ADP-ribose hydrolase 2; leukocyte antigen 65; Ly65; Ly-65; NAD(+) nucleosidase; NAD+ nucleosidase
Common Name CD157 (BST1)
Gene Symbol Bst1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.