missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30200146

Invitrogen™ Human CCL1 (aa 45-93) Control Fragment Recombinant Protein

Product Code. 30200146
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200146

Brand: Invitrogen™ RP101183

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (36%), Rat (36%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62067 (PA5-62067. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine is secreted by activated T cells and displays chemotactic activity for monocytes but not for neutrophils. It binds to the chemokine receptor CCR8.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P22362
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6346
Name Human CCL1 (aa 45-93) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias BF534335; C-C motif chemokine 1; C-C motif chemokine ligand 1; CCL 1; Ccl1; CCR8 ligand; chemokine (C-C motif) ligand 1; I-309; inflammatory cytokine I-309; P500; SCYA1; SISe; SIS-epsilon; small inducible cytokine A1; small inducible cytokine A1 (I-309, homologous to mouse Tca-3); small-inducible cytokine A1; T lymphocyte-secreted protein I-309; TCA3; TCA-3; T-cell activation protein 3
Common Name CCL1
Gene Symbol CCL1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.