missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30201093

Invitrogen™ Human CD53 (aa 111-180) Control Fragment Recombinant Protein

Product Code. 30201093
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30201093

Brand: Invitrogen™ RP91155

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83861 (PA5-83861. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD53 is a tetraspanin family transmembrane glycoprotein expressed in the lymphoid-myeloid lineage. This molecule has been reported to form complexes with other leukocyte surface proteins such as CD2, CD19, CD21, MHC II, VLA-4 or tetraspanins CD37, CD81 and CD82, thus probably modulating various signaling processes. CD53 is involved in radioresistancy of tumor cells and its triggering has anti-apoptotic effect. In thymus, CD53 is up-regulated in response to positive selection signals during T cell development, and is strongly expressed upon macrophage exposure to bacterial lipopolysaccharide, whereas stimulation of neutrophils results in down-regulation of CD53 expression.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P19397
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 963
Name Human CD53 (aa 111-180) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI323659; antigen MOX44 identified by monoclonal antibody MRC-OX44; Cd53; CD53 antigen; CD53 glycoprotein; CD53 molecule; CD53 tetraspan antigen; cell surface antigen; cell surface glycoprotein CD53; Leukocyte antigen MRC OX-44; leukocyte surface antigen CD53; MOX44; OX44; Ox-44; tetraspanin-25; transmembrane glycoprotein; TSPAN25; tspan-25
Common Name CD53
Gene Symbol Cd53
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.