missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CITED4 Partial ORF (NP_597724.1, 131 a.a. - 184 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00163732-Q01.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16045805

  • 545.00 € / 25µg
Estimated Shipment: 05-08-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

CITED4 belongs to a family of transcriptional coactivators that bind several proteins, including CREB-binding protein (MIM 600140) and p300 (MIM 602700).[supplied by OMIM]

Sequence: GMDAELIDEEALTSLELELGLHRVRELPELFLGQSEFDCFSDLGSAPPAGSVSC
Specifications

Specifications

NP_597724.1
Liquid
163732
CITED4 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CITED4
Wheat Germ (in vitro)
GST
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
31.68kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
GMDAELIDEEALTSLELELGLHRVRELPELFLGQSEFDCFSDLGSAPPAGSVSC
RUO
CITED4
Yes
wheat germ expression system
Videos
SDS
Documents
Certificates
Special Offers

Special Offers