missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30199996

Invitrogen™ Human COA6 (aa 50-123) Control Fragment Recombinant Protein

Product Code. 30199996
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30199996 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30199996 Supplier Invitrogen™ Supplier No. RP94445

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55908 (PA5-55908. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

C1orf31, also known as COA6, is a conserved mitochondrial protein required for respiratory complex IV biogenesis. Recently study reported that C1orf31 is required for maintenance of cytochrome c oxidase (CcO) subunit levels, and has role in the Cu delivery pathway to CcO. Defects in C1orf31 is associated with mitochondrial respiratory chain disease (MRCD). (24549041).
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q5JTJ3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 388753
Name Human COA6 (aa 50-123) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1810063B05Rik; AI447995; C1orf31; ca031; CEMCO x 4; Coa6; cytochrome c oxidase assembly factor 6; cytochrome c oxidase assembly factor 6 homolog; LOC102556031; uncharacterized LOC102556031
Common Name COA6
Gene Symbol COA6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PSMKERQVCWGARDEYWKCLDENLEDASQCKKLRSSFESSCPQQWIKYFDKRRDYLKFKEKFEAGQFEPSETTA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.