missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human COX2 (aa 442-572) Control Fragment Recombinant Protein

Product Code. 30181296
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30181296

Brand: Invitrogen™ RP99361

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

COX2 converts arachidonate to prostaglandin H2 (PGH2), a committed step in prostanoid synthesis, including production of inflammatory prostaglandins. The conversion of arachidonate to prostaglandin H2 is a 2 step reaction: a cyclooxygenase (COX) reaction which converts arachidonate to prostaglandin G2 (PGG2) and a peroxidase reaction in which PGG2 is reduced to prostaglandin H2 (PGH2). It is constitutively expressed in some tissues in physiological conditions, such as the endothelium, kidney and brain, and is up-regulated under pathological conditions, such as in cancer and inflammation (in contrast to the iso-enzyme PTGS1, which is expressed ubiquitously). Up-regulation of COX2 is also associated with increased cell adhesion, phenotypic changes, resistance to apoptosis and tumor angiogenesis. In cancer cells, COX2 is a key step in the production of prostaglandin E2 (PGE2), which plays important roles in modulating motility, proliferation and resistance to apoptosis. COX2 is naturally inhibited by calcitriol (the active form of Vitamin D). Glucocorticoids chronically trans-repress PTGS2 gene activity in vivo in part by interfering with transcription initiation and elongation. COX2 is a target of NSAID such as aspirin, which can reduce pain and swelling from inflammation driven by COX2.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P35354
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5743
Name Human COX2 (aa 442-572) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias COII; CO x 2; Cox-2; COXII; cyclooxygenase; cyclooxygenase 2; cyclooxygenase 2 b; cyclooxygenase-2; Cytochrome c oxidase polypeptide II; Cytochrome c oxidase subunit 2; cytochrome c oxidase subunit II; glucocorticoid-regulated inflammatory cyclooxygenase; Gripghs; hCox-2; Macrophage activation-associated marker protein P71/73; mitochondrially encoded cytochrome c oxidase II; MTCO2; MT-CO2; PES-2; PGG/HS; PGH synthase 2; Pghs2; PGHS-2; Pghs-b; PHS II; PHS-2; prostaglandin G/H synthase 2; Prostaglandin H2 synthase 2; prostaglandin-endoperoxide synthase 2; prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase); Ptgs2; Tis10; TIS10 protein
Common Name COX2
Gene Symbol PTGS2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAELEALYGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEVGFQIINTASIQSLICNNVKGCPFTSFSVPDPE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.