missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30200939

Invitrogen™ Human COX4 (aa 2-102) Control Fragment Recombinant Protein

Product Code. 30200939
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200939

Brand: Invitrogen™ RP102235

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. COX4 (COX4I1) is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P13073
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1327
Name Human COX4 (aa 2-102) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AL024441; C16orf2; C16orf4; COX; cox iv; COX IV-1; Cox IV-2; Co x 4; CO x 4 neighbor; Co x 4-1; CO x 4-2; Co x 4 A; CO x 4 AL; Co x 4 b; CO x 4I1; co x 4i1.S; Co x 4i2; CO x 4L2; CO x 4 NB; coxiv; COXIV-1; CoxIV-2; cytochrome c oxidase polypeptide IV; Cytochrome c oxidase subunit 4 isoform 1, mitochondrial; cytochrome c oxidase subunit 4 isoform 2, mitochondrial; cytochrome c oxidase subunit 4I1; cytochrome c oxidase subunit 4I2; cytochrome c oxidase subunit IV; cytochrome c oxidase subunit IV isoform 1; cytochrome c oxidase subunit IV isoform 1 precursor; cytochrome c oxidase subunit IV isoform 1 S homeolog; cytochrome c oxidase subunit IV isoform 2; cytochrome c oxidase subunit IV isoform 2 (lung); cytochrome c oxidase subunit IV precursor EC 1.9.3.1; cytochrome c oxidase subunit IV-like 2; cytochrome c oxidase, subunit 4 A; cytochrome c oxidase, subunit 4 b; cytochrome c oxidase, subunit IV; cytochrome c oxidase, subunit IVa; cytochrome c oxidase, subunit IVb; cytochrome c oxydase subunit 4; dJ857M17.2; EMC8; ER membrane protein complex subunit 8; FAM158B; family with sequence similarity 158, member B; FLJ23483; hypothetical protein MGC73355; IV-1; mg:bb02d03; MGC72016; Neighbor of CO x 4; NOC4; Protein FAM158B; XELAEV_18024950mg; zgc:110058; zgc:73355
Common Name COX4
Gene Symbol COX4I1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.