missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CRP (aa 22-98) Control Fragment Recombinant Protein

Product Code. 30199901
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199901

Brand: Invitrogen™ RP94194

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CRP (C-reactive protein) is a major cyclic, pentameric acute phase protein compound consisting of five identical, noncovalently bound, nonglycosylated subunits. Eeach subunit is made up of 206 amino acids, and has a molecular weight of 24 kDa. CRP is produced by the liver, and its plasma levels rise dramatically during inflammatory processes occurring in the body. CRP is an initiator of classical complement cascade, binds to several nuclear components (chromatin, histones, etc.), plays an important role in innate immunity, and mediates activities associated with pre-immune nonspecific host resistance. Specifically, there is a 100-1000 fold increase of CRP in response to injury, infection or inflammation. CRP is opsonic, an initiator of the classical complement cascade, and an activator of monocytes/macrophages. CRP also binds to several nuclear components including chromatin, histones and snRNP, suggesting that it may play a role as a scavenger during cell necrosis. CRP is involved in several host defense related functions based on its ability to recognize foreign pathogens and damaged cells of the host, and initiates pathogen elimination by interacting with humoral and cellular effector systems in the blood. Patients with elevated basal levels of CRP have been shown to be an increased risk for hypertension and cardiovascular disease.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P02741
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1401
Name Human CRP (aa 22-98) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Aa1249; Ab1-341; Ab2-196; Ac1-114; Ac1262; Ac2-069; acute phase protein; CRP; AI255847; Ba2-693; c reactive; C-reactive preprotein; C-reactive protein; C-reactive protein member of the pentraxin family; C-reactive protein(1-205); C-reactive protein, member of the pentraxin family; C-reactive protein, pentraxin-related; C-reactive protein, petaxin related; CRP; CRP1; CSRP; CYRP; D1S181E; DKFZp686M148; DKFZp686M149; MGC149895; MGC88244; pentraxin 1; PTX1; RP11-419N10.4
Common Name CRP
Gene Symbol Crp
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVGGS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.