missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30199310

Invitrogen™ Human CTDSP1 (aa 52-94) Control Fragment Recombinant Protein

Product Code. 30199310
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199310

Brand: Invitrogen™ RP107181

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66511 (PA5-66511. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CTDSP1 is a class 2C phosphatase with activity dependent on the conserved DxD motif. Expression of CTDSP1 inhibited activated transcription from several promoter-reporter gene constructs, but expression of a mutant lacking phosphatase activity enhanced transcription. Neuronal gene transcription is repressed in nonneuronal cells by the repressor element-1 (RE1)-silencing transcription factor/neuron-restrictive silencer factor (REST/NRSF; 600571) complex. REST/NRSF recruits SCPs to neuronal genes that contain RE1 elements, leading to neuronal gene silencing in nonneuronal cells. Phosphatase-inactive forms of SCP interfere with REST/NRSF function and promote neuronal differentiation of P19 stem cells. Likewise, small interfering RNA directed to the single Drosophila SCP unmasks neuronal gene expression in S2 cells. Thus, SCP activity is an evolutionarily conserved transcriptional regulator that acts globally to silence neuronal genes.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9GZU7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 58190
Name Human CTDSP1 (aa 52-94) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; CTD; CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 1; CTD small phosphatase 1; Ctdsp1; GIP; golli-interacting protein; Nif3; Nliif; NLI-IF; NLI-interacting factor 3; Nuclear LIM interactor-interacting factor 3; SCP1; small CTD phosphatase 1; Small C-terminal domain phosphatase 1
Common Name CTDSP1
Gene Symbol CTDSP1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EALPAHSGAPLLVEENGAIPKQTPVQYLLPEAKAQDSDKICVV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.