missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CYP11B2 (aa 406-451) Control Fragment Recombinant Protein

Product Code. 30181680
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
Product Code. Quantity unitSize
30181680 100 μL 100µL
1 options
This item is not returnable. View return policy

Product Code. 30181680

Brand: Invitrogen™ RP99283

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61902 (PA5-61902. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane and is involved in the conversion of progesterone to cortisol in the adrenal cortex. Mutations in this gene cause congenital adrenal hyperplasia due to 11-beta-hydroxylase deficiency. Transcript variants encoding different isoforms have been noted for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P19099
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1585
Name Human CYP11B2 (aa 406-451) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ALDOS; Aldosterone synthase; aldosterone-synthesizing enzyme; Corticosterone 18-monooxygenase, CYP11B2; Cp45as; Cpn2; Cyp11b; CYP11B2; Cyp11b-2; Cyp11b3; CYP11BL; CYPXIB2; CYPXIB3; cytochrome P450 11B2, mitochondrial; cytochrome P450 11B3, mitochondrial; cytochrome P450 family 11 subfamily B member 2; Cytochrome P450 subfamily XIB polypeptide 2 (aldosterone synthase); cytochrome P450, family 11, subfamily b, polypeptide 2; cytochrome P450, subfamily 11 B, polypeptide 2; cytochrome P450, subfamily XIB (steroid 11-beta-hydroxylase), polypeptide 2; Cytochrome P450, subfamily XIB, polypeptide 2 (aldosterone synthase); cytochrome P-450 Aldo; cytochrome P450-Aldo-1; cytochrome P450-Aldo-2; cytochrome P450C11; Cytochrome P-450C18; mitochondrial cytochrome P450, family 11, subfamily B, polypeptide 2; P450aldo; P450-Aldo-1; P450-Aldo-2; P450C 18; P-450 C 18; P450C18; P-450C18; RNCP45AS; steroid 11-beta/18-hydroxylase; steroid 11-beta-hydroxylase; Steroid 11-beta-hydroxylase, CYP11B2; steroid 11-beta-monooxygenase; Steroid 18-hydroxylase; steroid 18-hydroxylase, aldosterone synthase, P450C18, P450aldo; steroid-11-beta-hydroxylase
Common Name CYP11B2
Gene Symbol CYP11B2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.