missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30200578

Invitrogen™ Human DAAM2 (aa 838-906) Control Fragment Recombinant Protein

Product Code. 30200578
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200578

Brand: Invitrogen™ RP101347

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62373 (PA5-62373. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DAAM2 is a recently identified planar cell polarity (PCP) signaling molecule implicated in the regulation of cellular polarity, convergent extension, and invasion. DAAM2 belongs to the formin homology family and contains a DAD (diaphanous autoregulatory) domain, an FH1 (formin homology 1) domain, an FH2 (formin homology 2) domain and a GBD/FH3 (Rho GTPase-binding/ formin homology 3) domain. The DAAM2 protein is known to be involved in cell divison. Though the exact function of DAAM2 is yet unknown, reports suggest that it is closely related to DAAM1 and hence along with DAAM1 it may also be required in Wnt/Fz signaling and activation of Rho and in regulating cytoskeleton architecture. DAAM2 is expressed in most of tissues but the expression level ishigher in brain.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q86T65
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23500
Name Human DAAM2 (aa 838-906) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2310016D11Rik; AI843643; AW557870; Daam2; Disheveled-associated activator of morphogenesis 2; dishevelled associated activator of morphogenesis 2; dishevelled-associated activator of morphogenesis 2; dJ90A20A0.1; Kiaa0381; RP1-278E11.1
Common Name DAAM2
Gene Symbol DAAM2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NISLLHYLIMILEKHFPDILNMPSELQHLPEAAKVNLAELEKEVGNLRRGLRAVEVELEYQRRQVREPS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.