missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human DARC (aa 2-60) Control Fragment Recombinant Protein

Product Code. 30200330
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30200330 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30200330 Supplier Invitrogen™ Supplier No. RP90871

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (45%), Rat (45%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82594 (PA5-82594. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ACKR1 or DARC is an atypical chemokine receptor that controls chemokine levels and localization via high-affinity chemokine binding that is uncoupled from classic ligand-driven signal transduction cascades resulting instead in chemokine sequestration, degradation, or transcytosis. ACKR1 is also known as an interceptor (internalizing receptor) or chemokine-scavenging receptor or chemokine decoy receptor. It has a promiscuous chemokine-binding profile by interacting with inflammatory chemokines of both the CXC and the CC subfamilies but not with homeostatic chemokines. ACKR1 also acts as a receptor for chemokines including CCL2, CCL5, CCL7, CCL11, CCL13, CCL14, CCL17, CXCL5, CXCL6, IL8/CXCL8, CXCL11, GRO, RANTES, MCP-1, TARC and for the malaria parasites P.vivax and P.knowlesi.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q16570
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2532
Name Human DARC (aa 2-60) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA162249; ACKR1; Atypical chemokine receptor 1; atypical chemokine receptor 1 (Duffy blood group); CCBP1; CD234; CD234 antigen; CTA-134P22.3; DARC; Dfy; Duffy Antigen; Duffy antigen chemokine receptor; Duffy antigen receptor for chemokines; duffy antigen/chemokine receptor; Duffy blood group antigen; duffy blood group chemokine receptor; Duffy blood group, atypical chemokine receptor; Duffy blood group, chemokine receptor; ESTM35; FY; Fy Antigen; Fy glycoprotein; FYDuffy blood group; glycoprotein D; GPD; GPDWBCQ1; GpFy; HGNC:4035; OTTHUMP00000060081; Plasmodium vivax receptor; WBCQ1
Common Name DARC
Gene Symbol ACKR1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.