missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30200330

Invitrogen™ Human DARC (aa 2-60) Control Fragment Recombinant Protein

Product Code. 30200330
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200330

Brand: Invitrogen™ RP90871

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (45%), Rat (45%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82594 (PA5-82594. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ACKR1 or DARC is an atypical chemokine receptor that controls chemokine levels and localization via high-affinity chemokine binding that is uncoupled from classic ligand-driven signal transduction cascades resulting instead in chemokine sequestration, degradation, or transcytosis. ACKR1 is also known as an interceptor (internalizing receptor) or chemokine-scavenging receptor or chemokine decoy receptor. It has a promiscuous chemokine-binding profile by interacting with inflammatory chemokines of both the CXC and the CC subfamilies but not with homeostatic chemokines. ACKR1 also acts as a receptor for chemokines including CCL2, CCL5, CCL7, CCL11, CCL13, CCL14, CCL17, CXCL5, CXCL6, IL8/CXCL8, CXCL11, GRO, RANTES, MCP-1, TARC and for the malaria parasites P.vivax and P.knowlesi.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q16570
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2532
Name Human DARC (aa 2-60) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA162249; ACKR1; Atypical chemokine receptor 1; atypical chemokine receptor 1 (Duffy blood group); CCBP1; CD234; CD234 antigen; CTA-134P22.3; DARC; Dfy; Duffy Antigen; Duffy antigen chemokine receptor; Duffy antigen receptor for chemokines; duffy antigen/chemokine receptor; Duffy blood group antigen; duffy blood group chemokine receptor; Duffy blood group, atypical chemokine receptor; Duffy blood group, chemokine receptor; ESTM35; FY; Fy Antigen; Fy glycoprotein; FYDuffy blood group; glycoprotein D; GPD; GPDWBCQ1; GpFy; HGNC:4035; OTTHUMP00000060081; Plasmodium vivax receptor; WBCQ1
Common Name DARC
Gene Symbol ACKR1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.