missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30206711

Invitrogen™ Human DGKD (aa 979-1109) Control Fragment Recombinant Protein

Product Code. 30206711
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30206711 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30206711 Supplier Invitrogen™ Supplier No. RP104581

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110941 (PA5-110941. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Diacylglycerol kinases (DGKs) phosphorylate diacylglycerol (DAG) to produce phosphatidic acid. DAG and phosphatidic acid are lipids that act as second messengers in signaling cascades. DGK-alpha influences cell activation and secretion of lethal exosomes, which in turn control cell death. DGK-beta is abundant in restricted brain regions such as the caudate putamen and olfactory tubercle. DGK-gamma encodes full-length and truncated transcripts that are present in a range of human tissues, with greatest expression observed in retina. DGK-delta is most abundant in skeletal muscle. DGK-epsilon shows specificity for arachidonylcontaining diacylglycerol and is expressed predominantly in testis. DGK-theta is most abundant in the cerebellum and hippocampus. DGK-iota is present in brain and retina as a predominant transcript of more than 12 kb, including a long 3-prime untranslated region, with additional low abundance transcripts of 9.5 and 7.5 kb. DGK-eta is closely related to DGK-delta. DGK-zeta is most abundant in brain and muscle. DGKs have structural motifs that play regulatory roles, and these motifs form the basis for dividing the DGKs into five subtypes.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q16760
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8527
Name Human DGKD (aa 979-1109) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 130 kDa diacylglycerol kinase; AI841987; D330025K09; DAG kinase delta; DGK delta; DGKD; dgkd-2; DGKdelta; DGK-delta; Diacylglycerol kinase delta; diacylglycerol kinase, delta; diacylglycerol kinase, delta 130 kDa; Diglyceride kinase; diglyceride kinase delta; EC 2.7.1.107; FLJ26930; hypothetical protein LOC513389; KIAA0145; RGD1563309
Common Name DGKD
Gene Symbol DGKD
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TQMDQFGQAAGVLIHSIREIAQSHRDMEQELAHAVNASSKSMDRVYGKPRTTEGLNCSFVLEMVNNFRALRSETELLLSGKMALQLDPPQKEQLGSALAEMDRQLRRLADTPWLCQSAEPGDEESVMLDLA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.