missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30207078

Invitrogen™ Human DNA-PK (aa 3478-3559) Control Fragment Recombinant Protein

Product Code. 30207078
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30207078

Brand: Invitrogen™ RP97237

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83261 (PA5-83261. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DNA-PK is a heterotrimeric, DNA-dependent protein kinase that initiates signaling cascades in response to DNA damage. DNA-PK is an atypical kinase, closely related to the PI3 kinases, and is often potently inhibited by small molecules designed to target PI3 kinases. DNA-PK encodes a component of the mediator complex, a transcriptional coactivator complex thought to be required for the expression of almost all genes. The mediator complex is recruited by transcriptional activators or nuclear receptors to induce gene expression, possibly by interacting with RNA polymerase II and promoting the formation of a transcriptional pre-initiation complex. Multiple transcript variants encoding different isoforms have been found for DNA-PK.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P78527
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5591
Name Human DNA-Pk. (aa 3478-3559) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI326420; AU019811; DNA-dependent protein kinase catalytic subunit; DNAPDcs; DNAPK; DNA-Pk. catalytic subunit; DNA-PKcs; DNPK1; DOXNPH; doxorubicin nephropathy; dxnph; hyper-radiosensitivity of murine scid mutation, complementing 1; HYRC; HYRC1; I79_017613; IMD26; p350; p460; Prkdc; protein kinase, DNA activated, catalytic polypeptide; protein kinase, DNA-activated, catalytic polypeptide; scid; severe combined immunodeficiency; slip; Xrcc7
Common Name DNA-Pk.
Gene Symbol PRKDC
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ETLSLMTKEISSVPCWQFISWISHMVALLDKDQAVAVQHSVEEITDNYPQAIVYPFIISSESYSFKDTSTGHKNKEFVARIK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.