missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Endostatin (aa 1445-1516) Control Fragment Recombinant Protein

Product Code. 30201465
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30201465

Brand: Invitrogen™ RP105916

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Endostatin is able to avoke non-uniform response for proliferation, cell mount and migration of entothelial cells, which different endostatin binding characteristic, leads to the assumption that endostatin effect is strongly dependent from endothelial cell type. Furthermore endostatin inhibits angiogenesis and tumor growth in vivo by inducing apoptosis in endothelial cells. The local delivery of endostatin seems to specifically affect tumor-associated microvessels by reduction of the vessel density, diameter and functionality. Tumor cell migration and invasion was greatly reduced in the endostatin treated animals. Endostatin is non-toxic and does not induce aquired drug resistance and has therefor become a potent new therapy strategy in solid neoplasias. This therapy appears to have a high potential not only for the treatment of gliomas, the most common brain tumors, but also in other tumors. The ability of endostatin to inhibit neoangiogenesis is mediated, at least in part, by Zn^+2 binding and elastase processing. Widespread endostatin expression was found in elactic fibers in vessel walls and in some other basement membrane zones. Endostatin is released by neurons to accumulate in amyloid plaques in Alzheimer's disease.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P39060
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 80781
Name Human Endostatin (aa 1445-1516) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias antiangiogenic agent; Col18a1; Collagen alpha-1(XVIII) chain; collagen type XVIII alpha 1 chain; collagen, type XVIII, alpha 1; endostatin; FLJ27325; FLJ34914; KNO; KNO1; KS; MGC74745; multi-functional protein MFP; NC1; Non-collagenous domain 1; procollagen, type XVIII, alpha 1
Common Name Endostatin
Gene Symbol COL18A1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VRLWATRQAMLGQVHEVPEGWLIFVAEQEELYVRVQNGFRKVQLEARTPLPRGTDNEVAALQPPVVQLHDSN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.