missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human EPS8L1 (aa 11-90) Control Fragment Recombinant Protein

Product Code. 30181815
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30181815 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30181815 Supplier Invitrogen™ Supplier No. RP99081

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60413 (PA5-60413. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Eps8L1 (EPS8-like 1), also known as DRC3 or EPS8R1, is a 723 amino acid protein that localizes to the cytoplasm and belongs to the Eps8 (epidermal growth factor receptor pathway substrate 8) family. Expressed in placental tissue, Eps8L1 functions to stimulate the guanine exchange activity of Sos 1 (son of sevenless homolog 1), a protein that promotes the exchange of Ras-bound GDP for GTP. Additionally, Eps8L1 is thought to associate with Actin and, via this association, may play a role in membrane ruffling and remodeling of the Actin cytoskeleton. Through its ability to regulate protein activation and cytoskeleton dynamics, Eps8L1 may participate in cell growth and differentiation events within the cell. Eps8L1 contains one SH3 domain and is expressed as four isoforms due to alternative splicing events.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8TE68
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 54869
Name Human EPS8L1 (aa 11-90) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2310051G19Rik; 4632407K17Rik; AW060268; DRC3; Epidermal growth factor receptor kinase substrate 8-like protein 1; epidermal growth factor receptor pathway substrate 8-related protein 1; EPS8 like 1; Eps8l1; EPS8-like 1; EPS8-like protein 1; Eps8r1; EPS8-related protein 1; PP10566
Common Name EPS8L1
Gene Symbol EPS8L1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PKPSAKSIYEQRKRYSTVVMADVSQYPVNHLVTFCLGEDDGVHTVEDASRKLAVMDSQGRVWAQEMLLRVSPDHVTLLDP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.