missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30207209

Invitrogen™ Human Factor V (aa 1490-1614) Control Fragment Recombinant Protein

Product Code. 30207209
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30207209

Brand: Invitrogen™ RP100492

Please to purchase this item. Need a web account? Register with us today!

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (60%), Rat (60%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-81998 (PA5-81998. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Coagulation factor V (or Proaccelerin) is an essential factor of the blood coagulation cascade. This factor circulates in plasma, and is converted to the active form by the release of the activation peptide by thrombin during coagulation. This generates a heavy chain and a light chain which are held together by calcium ions. The active factor V is a cofactor that participates with activated coagulation factor X to activate prothrombin to thrombin. Defects in the Factor V gene can result various diseases including Factor V deficiency, thrombophilia due to activated protein C resistance, Budd-Chiari syndrome, Ischemic stroke, and recurrent pregnancy loss.
TRUSTED_SUSTAINABILITY

Especificaciones

Accession Number P12259
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2153
Name Human Factor V (aa 1490-1614) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Ac2-120; Activated protein C cofactor; AI173222; Cf5; Cf-5; coagulation factor V; coagulation factor V (proaccelerin, labile factor); Coagulation factor V heavy chain; coagulation factor V jinjiang A2 domain; Coagulation factor V light chain; F5; Factor 5; factor V; factor V Leiden; Factor5; FVL; PCCF; Proaccelerin, labile factor; RPRGL1; THPH2
Common Name Factor V
Gene Symbol F5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MPSPSSPTLNDTFLSKEFNPLVIVGLSKDGTDYIEIIPKEEVQSSEDDYAEIDYVPYDDPYKTDVRTNINSSRDPDNIAAWYLRSNNGNRRNYYIAAEEISWDYSEFVQRETDIEDSDDIPEDTT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado