missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30208681

Invitrogen™ Human FAU (aa 102-132) Control Fragment Recombinant Protein

Product Code. 30208681
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30208681

Brand: Invitrogen™ RP101930

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111476 (PA5-111476. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is the cellular homolog of the fox sequence in the Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV). It encodes a fusion protein consisting of the ubiquitin-like protein fubi at the N terminus and ribosomal protein S30 at the C terminus. It has been proposed that the fusion protein is post-translationally processed to generate free fubi and free ribosomal protein S30. Fubi is a member of the ubiquitin family, and ribosomal protein S30 belongs to the S30E family of ribosomal proteins. Whereas the function of fubi is currently unknown, ribosomal protein S30 is a component of the 40S subunit of the cytoplasmic ribosome and displays antimicrobial activity. Pseudogenes derived from this gene are present in the genome. Similar to ribosomal protein S30, ribosomal proteins S27a and L40 are synthesized as fusion proteins with ubiquitin.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P62861
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2197
Name Human FAU (aa 102-132) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 40 S ribosomal protein S30; 40 S ribosomal protein S30; ubiquitin-like protein fubi and ribosomal protein S30; asr1; Fau; FAU ubiquitin like and ribosomal protein S30 fusion; FAU, ubiquitin like and ribosomal protein S30 fusion; FAU1; FAU-encoded ubiquitin-like protein; FBR-MuSV-associated ubiquitously expressed; Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed; Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed (fox derived); Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed (fox derived) protein; Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed (fox derived); ribosomal protein S30; Finkel-Biskis-Reilly murine sarcoma virusubiquitously expressed; Fub1; Fubi; MNSFbeta; MNSF-beta; monoclonal nonspecific suppressor factor beta; Monoclonal non-specific suppressor factor beta; monoclonal nonspecific suppressor factor betamonoclonal nonspecific suppressor factor beta; ribosomal protein S30; RP MNSFbeta; RPS30; S30; ubiquitin-like protein FUBI; ubiquitin-like protein fubi and ribosomal protein S30; ubiquitin-like/S30 ribosomal fusion protein; ubiquitin-like-S30 fusion protein
Common Name FAU
Gene Symbol FAU
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KTGRAKRRMQYNRRFVNVVPTFGKKKGPNAN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.