missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30200582

Invitrogen™ Human FMRP (aa 317-373) Control Fragment Recombinant Protein

Product Code. 30200582
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200582

Brand: Invitrogen™ RP103247

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FMR1 binds RNA and is associated with polysomes. The protein may be involved in mRNA trafficking from the nucleus to the cytoplasm. A trinucleotide repeat in the 5' UTR is normally found at 6-53 copies, but an expansion to 55-230 repeats is the cause of fragile X syndrome. Expansion of the trinucleotide repeat may also cause one form of premature ovarian failure. Multiple alternatively spliced transcript variants that encode different protein isoforms and which are located in different cellular locations have been described for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q06787
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2332
Name Human FMRP (aa 317-373) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AT24755; BcDNA:GM08679; cg 6203 gene product from transcript cg6203-rc; cg6203; CG6203-PA; CG6203-PB; CG6203-PC; CG6203-PD; CG6203-PE; CG6203-PF; CG6203-PG; CG6203-PH; CG6203-PI; CG6203-PJ; CG6203-Pk.; dFMR; DFmr1; dFmrp; dfxr; dfxr1; dFXRP; Dmel\CG6203; Dmel_CG6203; dmfr1; drosophila fragile x mental retardation protein; EP(3)3517; FMR; FMR1; Fmr-1; Fmr1-PA; Fmr1-PB; Fmr1-PC; Fmr1-PD; Fmr1-PE; Fmr1-PF; Fmr1-PG; Fmr1-PH; Fmr1-PI; Fmr1-PJ; Fmr1-Pk.; FMRP; FMRP translational regulator 1; fragile X; fragile x mental retardation; fragile x mental retardation 1; fragile x mental retardation gene; fragile x mental retardation protein; fragile x mental retardation protein 1; Fragile x mental retardation protein 1 homolog; fragile x mental retardation related 1; fragile x mental retardation syndrome 1; fragile x mental retardation syndrome 1 homolog; Fragile x mental retardation syndrome-related protein 1; fragile x mental retardation-1 protein; fragile x protein; fragile x related; fragile x related protein; fragile x retardation 1 protein; fragile X-related; fragile-X; Fragile-X mental retardation 1; Fragile-X mental retardation protein; Fragile-X-related; FRAXA; FXR; MGC87458; POF; POF1; protein FMR-1; ragile x mental retardation protein; synaptic functional regulator FMR1
Common Name FMRP
Gene Symbol FMR1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RIEAENEKNVPQEEEIMPPNSLPSNNSRVGPNAPEEKKHLDIKENSTHFSQPNSTKV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.