missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30200231

Invitrogen™ Human FTSJ2 (aa 100-171) Control Fragment Recombinant Protein

Product Code. 30200231
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30200231 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30200231 Supplier Invitrogen™ Supplier No. RP92696

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54090 (PA5-54090. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Putative ribosomal RNA methyltransferase 2 (FTSJ2), also named as FJH1 or Protein FTSJ homolog 2 is a 246 amino acid protein, which belongs to the methyl-transferase superfamily. FTSJ2 localizes in the nucleus and is widely expressed in in muscle, placenta, and heart. FTSJ2 functions as a nucleolar RNA methyl-transferase involved in eukaryotic RNA processing and modification.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9UI43
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 29960
Name Human FTSJ2 (aa 100-171) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 16 S rRNA (uridine(1369)-2'-O)-methyltransferase; 16 S rRNA [Um1369] 2'-O-methyltransferase; 2310037B18Rik; cell division protein FtsJ; epididymis luminal protein 97; FJH1; FtsJ homolog 2; FtsJ homolog 2 (E. coli); FtsJ RNA methyltransferase homolog 2; FTSJ2; HEL97; mitochondrial rRNA methyltransferase 2; Mrm2; MRM2 RNA methyltransferase homolog; protein ftsJ homolog 2; putative ribosomal RNA methyltransferase 2; RRMJ2; rRNA (uridine-2'-O-)-methyltransferase; rRNA methyltransferase 2, mitochondrial
Common Name FTSJ2
Gene Symbol MRM2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DPSSPVGFVLGVDLLHIFPLEGATFLCPADVTDPRTSQRILEVLPGRRADVILSDMAPNATGFRDLDHDRLI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.