missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30201002

Invitrogen™ Human FZD4 (aa 130-215) Control Fragment Recombinant Protein

Product Code. 30201002
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30201002

Brand: Invitrogen™ RP105592

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FZD4 is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence. Frizzled 4 is widely expressed, particularly in heart, skeletal muscle, ovary, and fetal kidney. Transcripts have also been identified in liver, kidney, pancreas, spleen, and fetal lung, and in smaller amounts in placenta, adult lung, prostate, testis, colon, and fetal brain.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9ULV1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8322
Name Human FZD4 (aa 130-215) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias CD344; CD344 antigen; EVR1; FEVR; frizzled 4, seven transmembrane spanning receptor; frizzled class receptor 4; frizzled family receptor 4; frizzled homolog 4; frizzled homolog 4 (Drosophila); frizzled receptor 4; frizzled-4; Fz4; Fz-4; Fzd4; FZD4S; FzE4; GPCR; hFz4; mFz4; MGC34390; rFz4; WNT receptor frizzled-4
Common Name FZD4
Gene Symbol FZD4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.