missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30201386

Invitrogen™ Human GM-CSF (aa 26-83) Control Fragment Recombinant Protein

Product Code. 30201386
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30201386

Brand: Invitrogen™ RP106775

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (50%), Rat (50%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The GM-CSF gene encodes for a cytokine that regulates the production, differentiation, and function of macrophages and granulocytes. The active form of the protein exists as a homodimer in the extracellular space. This gene is located in a cluster of related genes at the chromosome region 5q31, which has been associated with interstitial deletions in the 5q- syndrome and acute myelogenous leukemia. Other genes in the cluster include interleukins 4, 5, and 13. The gene is involved in promoting tissue inflammation. Elevated levels of cytokines, including the one produced by this gene, have been observed in SARS-CoV-2 infected patients with acute respiratory distress syndrome. Mice that lack this gene or its receptor have been shown to develop pulmonary alveolar proteinosis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P04141
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1437
Name Human GM-CSF (aa 26-83) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias colony stimulating factor 2; colony stimulating factor 2 (granulocyte-macrophage); colony-stimulating factor; CSF; CSF2; Csfgm; cytokine; GMCSF; Gm-CSf; granulocyte macrophage colony stimulating factor; granulocyte macrophage-colony stimulating factor; granulocyte-macrophage colony stimulating factor 2; granulocyte-macrophage colony-stimulating factor; MGC131935; MGC138897; MGC151255; MGC151257; MGI-IGM; M-GM-CSF; molgramostin; put. GM-CSF; sargramostim
Common Name GM-CSF
Gene Symbol CSF2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence STQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.