missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30208306

Invitrogen™ Human HYD (aa 333-424) Control Fragment Recombinant Protein

Product Code. 30208306
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30208306 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30208306 Supplier Invitrogen™ Supplier No. RP106488

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65815 (PA5-65815. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

EDD (for E3 identified by Differential Display) is a progestin-regulated gene that was isolated from T-47D human breast cancer cells. Based on sequence homology, EDD appears to be a human homolog of the Drosophila hyperplastic discs (hyd) gene, a tumor suppressor gene that is required for control of imaginal disc growth. EDD contains a HECT domain in the carboxy terminus. HECT domain-containing proteins function as ubiquitin-protein ligases, or E3 enzymes. EDD has been shown to bind to ubiquitin, and like other HECT family proteins, may function as an E3 ubiquitin-protein ligase.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O95071
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51366
Name Human HYD (aa 333-424) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias CH D1S3362; DD5; E3 identified by differential display; E3 ubiquitin-protein ligase UBR5; E3 ubiquitin-protein ligase, HECT domain-containing 1; ECGF1; Edd; Edd1; EDG1; EDG-1; extraembryonic development; HECT-type E3 ubiquitin transferase UBR5; hHYD; HYD; Hyperplastic discs protein homolog; KIAA0896; Progestin-induced protein; Rat100; S1P receptor 1; S1P receptor Edg-1; S1P1; S1PR1; ubiquitin protein ligase E3 component n-recognin 5; Ubr5
Common Name HYD
Gene Symbol UBR5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GSTSKEGEPNLDKKNTPVQSPVSLGEDLQWWPDKDGTKFICIGALYSELLAVSSKGELYQWKWSESEPYRNAQNPSLHHPRATFLGLTNEKI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.