missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human KLHL29 (aa 773-848) Control Fragment Recombinant Protein

Product Code. 30199418
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30199418 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30199418 Supplier Invitrogen™ Supplier No. RP109856

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144759 (PA5-144759. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

KLHL29 (Kelch-like protein 29), also known as KBTBD9, is a 655 amino acid protein that is related to the Drosophila Kelch protein. Mutations affecting Kelch function result in failure of Kelch to associate with the ring canals and subsequent female sterility. Human KLHL29 contains six kelch repeats and one BTB (POZ) domain. The BTB (Broad-Complex, Tramtrack and Bric a brac) domain, also known as the POZ (Poxvirus and Zinc finger) domain, is an N-terminal homodimerization domain that contains multiple copies of kelch repeats and/or C2H2-type zinc fingers. Proteins that contain BTB domains are thought to be involved in transcriptional regulation via control of chromatin structure and function. KLHL29 exists as two alternatively spliced isoforms which are encoded by a gene that maps to human chromosome 2p24.1.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96CT2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 114818
Name Human KLHL29 (aa 773-848) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A230106N14Rik; Gm68; KBTBD9; kelch like family member 29; kelch repeat and BTB (POZ) domain containing 9; kelch repeat and BTB domain-containing protein 9; kelch-like 29; kelch-like family member 29; kelch-like protein 29; Kiaa1921; Klhl29; mKIAA1921
Common Name KLHL29
Gene Symbol KLHL29
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AVTLNGFVFILGGAYARATTIYDPEKGNIKAGPNMNHSRQFCSAVVLDGKIYATGGIVSSEGPALGNMEAYEPTTN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.