missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30209277

Invitrogen™ Human LYSMD1 (aa 146-227) Control Fragment Recombinant Protein

Product Code. 30209277
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30209277 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30209277 Supplier Invitrogen™ Supplier No. RP94422

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55755 (PA5-55755. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LYSMD1 (LysM Domain Containing 1) is a Protein Coding gene. Diseases associated with LYSMD1 include 3-Methylglutaconic Aciduria, Type Vii. An important paralog of this gene is LYSMD2. [GeneCards]
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96S90
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 388695
Name Human LYSMD1 (aa 146-227) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2610022K04Rik; AI415311; lysM and putative peptidoglycan-binding domain-containing protein 1; LysM domain containing 1; LysM, putative peptidoglycan-binding, domain containing 1; Lysmd1; RP11-68I18.5; SB145
Common Name LYSMD1
Gene Symbol LYSMD1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PTPIHDLSASDFLKKLDSQISLSKKAAAQKLKKGENGVPGEDAGLHLSSPWMQQRAVLGPVPLTRTSRTRTLRDQEDEIFKL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.