missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MAK10 (aa 567-665) Control Fragment Recombinant Protein

Product Code. 30201505
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30201505 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30201505 Supplier Invitrogen™ Supplier No. RP92956
 Restricted Item
Estimated Shipment: 20-08-2026
Læg i indkøbskurv
Læg i indkøbskurv
Denne vare kan ikke returneres. Se returpolicy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54446. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The MAK10 gene encodes a 733-amino acid protein with several regions of similarity to T cell receptor alpha-subunit V (variable) regions in yeast. The mammalian homologue of yeast MAK10, also known as EGAP, is one subunit of a novel N-terminal acetyltransferase (NAT) that is highly conserved among vertebrate species. It is expressed in a variety of tissues in the developing rat embryo but restricted in expression in the adult, remaining detectable only in tissues undergoing continual cell renewal or in cells responding to pathological injury. The MAK10-NAT complex is an essential regulatory enzyme controlling the function of a subset of proteins required for embryonic growth control and vessel development. This complex functionally co-assembles in mammalian cells to regulate cell proliferation and is essential for embryonic development, at least in part through the regulation of target of rapamycin (TOR) signaling events. At least two isoforms of MAK10 are known to exist.
TRUSTED_SUSTAINABILITY

Tekniske data

Accession Number Q5VZE5
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 60560
Name Human MAK10 (aa 567-665) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias A330021G12Rik; A330027C19Rik; AI158944; bA379P1.1; C030004C14Rik; corneal wound healing related protein; corneal wound healing-related protein; corneal wound-healing-related protein; EGAP; Emb8; Embryonic growth-associated protein; embryonic growth-associated protein homolog; Mak10; MAK10 homolog, amino-acid N-acetyltransferase subunit; MAK10P; N(alpha)-acetyltransferase 35, NatC auxiliary subunit; NAA35; Nalpha acetyltransferase 35; N-alpha-acetyltransferase 35, NatC auxiliary subunit; protein MAK10 homolog; RAT52; RP11-379P1.1; T4a
Common Name MAK10
Gene Symbol NAA35
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KKVRPLSREITMSQAYQNMCAGMFKTMVAFDMDGKVRKPKFELDSEQVRYEHRFAPFNSVMTPPPVHYLQFKEMSDLNKYSPPPQSPELYVAASKHFQQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.