missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30201505

Invitrogen™ Human MAK10 (aa 567-665) Control Fragment Recombinant Protein

Product Code. 30201505
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30201505

Brand: Invitrogen™ RP92956

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54446 (PA5-54446. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The MAK10 gene encodes a 733-amino acid protein with several regions of similarity to T cell receptor alpha-subunit V (variable) regions in yeast. The mammalian homologue of yeast MAK10, also known as EGAP, is one subunit of a novel N-terminal acetyltransferase (NAT) that is highly conserved among vertebrate species. It is expressed in a variety of tissues in the developing rat embryo but restricted in expression in the adult, remaining detectable only in tissues undergoing continual cell renewal or in cells responding to pathological injury. The MAK10-NAT complex is an essential regulatory enzyme controlling the function of a subset of proteins required for embryonic growth control and vessel development. This complex functionally co-assembles in mammalian cells to regulate cell proliferation and is essential for embryonic development, at least in part through the regulation of target of rapamycin (TOR) signaling events. At least two isoforms of MAK10 are known to exist.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q5VZE5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 60560
Name Human MAK10 (aa 567-665) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A330021G12Rik; A330027C19Rik; AI158944; bA379P1.1; C030004C14Rik; corneal wound healing related protein; corneal wound healing-related protein; corneal wound-healing-related protein; EGAP; Emb8; Embryonic growth-associated protein; embryonic growth-associated protein homolog; Mak10; MAK10 homolog, amino-acid N-acetyltransferase subunit; MAK10P; N(alpha)-acetyltransferase 35, NatC auxiliary subunit; NAA35; Nalpha acetyltransferase 35; N-alpha-acetyltransferase 35, NatC auxiliary subunit; protein MAK10 homolog; RAT52; RP11-379P1.1; T4a
Common Name MAK10
Gene Symbol NAA35
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KKVRPLSREITMSQAYQNMCAGMFKTMVAFDMDGKVRKPKFELDSEQVRYEHRFAPFNSVMTPPPVHYLQFKEMSDLNKYSPPPQSPELYVAASKHFQQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.