missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human MEOX1 Partial ORF (NP_004518.1, 165 a.a. - 252 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00004222-Q01.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16044395

  • 359.00 € / 10µg
Estimated Shipment: 16-08-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the molecular signaling network regulating somite development. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq]

Sequence: PEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPISPNGQDPEDGDSTASPS
Specifications

Specifications

NP_004518.1
Liquid
4222
MEOX1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MOX1
MEOX1
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.42kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
PEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPISPNGQDPEDGDSTASPS
RUO
MEOX1
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers