missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MXI1 (aa 22-98) Control Fragment Recombinant Protein

Product Code. 30199967
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199967

Brand: Invitrogen™ RP108811

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

It is now well established that Myc regulation of cell proliferation and differentiation involves a family of related transcription factors. One such factor, Max, is an obligate heterodimeric partner for Myc and can also form heterodimers with at least four related proteins designated Mad 1, Mxi1, Mad 3 and Mad 4. Like Mad 1 and Mxi1, association of Mad 3 and Mad 4 with Max results in transcriptional repression. Both Myc and the Mad proteins have short half-lives and their synthesis is tightly regulated, while Max expression is constitutive and relatively stable. Two related mammalian cDNAs have been identified and shown to encode Mad-binding proteins. Both possess sequence homology with the yeast transcription repressor Sin3 including four conserved paired amphipathic helix (PAH) domains. mSin3A and mSin3B specifically interact with the Mad proteins via their second paired amphipathic helix domain (PAH2). It has been suggested that Mad-Max heterodimers repress transcription by tethering mSin3 to DNA as corepressors.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P50539
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4601
Name Human MXI1 (aa 22-98) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias bHLHc11; class C basic helix-loop-helix protein 11; ENSMUSG00000067085; Gm10197; Mad2; MAX dimerization protein 2; Max interacting protein 1; MAX interactor 1; MAX interactor 1, dimerization protein; max-interacting protein 1; Max-interacting protein 1-like protein; Max-related transcription factor; MGC43220; MXD2; MXI; MXI1; MXI-WR; RP11-549L6.1
Common Name MXI1
Gene Symbol Mxi1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RERECEHGYASSFPSMPSPRLQHSKPPRRLSRAQKHSSGSSNTSTANRSTHNELEKNRRAHLRLCLERLKVLIPLGP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.